AMAB91030
Monoclonal Anti-NEFM antibody produced in mouse
Prestige Antibodies® Powered by Atlas Antibodies, clone CL2705, purified immunoglobulin, buffered aqueous glycerol solution
Synonym(s):
NEF3, NF-M, NFM
Sign Into View Organizational & Contract Pricing
All Photos(9)
About This Item
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
CL2705, monoclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, rat, human
technique(s)
immunoblotting: 1 μg/mL
immunohistochemistry: 1:5000- 1:10000
isotype
IgG2b
immunogen sequence
YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NEFM(4741)
General description
Neurofilament medium (NEFM) gene encodes neurofilament medium polypeptide which constitutes to cytoskeleton of mature neurons. The gene in human chromosome is localized on 8p21.
Immunogen
neurofilament, medium polypeptide
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Neurofilament medium (NEFM) is essential for radial growth of axon which includes the diameter of the axon as well as the myelination. The C-terminus of NFEM gene has 7 repeats of KSP (lysine-serine-proline) domain and phosphorylation of which is crucial for regulating the radial growth of axon. NEFM is related to several cancers especially breast cancers in which NEFM gene silencing by methylation leads to disease progression. Mutations in NEFM results in decreased diameter of axon and hence deficiency of neurons.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Assembly and structure of neurofilaments
Janmey PA, et al.
Current Opinion in Colloid & Interface Science, 8(1), 40-47 (2003)
Epigenetic silencing of neurofilament genes promotes an aggressive phenotype in breast cancer
Calmon MF, et al.
Epigenetics, 10(7), 622-632 (2015)
NF-M is an essential target for the myelin-directed ?outside-in? signaling cascade that mediates radial axonal growth
Garcia ML, et al.
The Journal of Cell Biology, 163(5), 1011-1020 (2003)
Expansion of neurofilament medium C terminus increases axonal diameter independent of increases in conduction velocity or myelin thickness
Barry DM, et al.
The Journal of Neuroscience, 32(18), 6209-6219 (2012)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service