Accéder au contenu
Merck
Toutes les photos(3)

Documents

WH0004904M1

Sigma-Aldrich

Monoclonal Anti-YBX1 antibody produced in mouse

clone 4F12, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-BP8, Anti-CSDB, Anti-DBPB, Anti-MDRNF1, Anti-MGC104858, Anti-MGC110976, Anti-NSEP1, Anti-YB1, Anti-YBX1, Anti-nuclease sensitive element binding protein 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4F12, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_004559

Numéro d'accès UniProt

P67809

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... YBX1(4904)

Description générale

Y-box binding protein 1 (YBX1) gene codes for Y-box protein 1 (YB-1) that has 324 amino acid residues, 8 exons and 7 introns. It is a member of the family of multifunctional DNA/RNA binding proteins. It is mainly present in the cytosol. YBX1 gene is mapped to human chromosome 1p34.

Immunogène

YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA

Actions biochimiques/physiologiques

Y-box binding protein 1 (YBX1) participates in pre-mRNA splicing, transcriptional regulation and mRNA translation and stability. It is also involved in DNA repair and environmental stress responses and chromatin remodeling.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

YBX1 (Y box binding protein 1)
Evdokimova V and Sorokin A
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Andreas Zaucker et al.
Nucleic acids research, 46(1), 104-119 (2017-10-24)
In many organisms, transcriptional and post-transcriptional regulation of components of pathways or processes has been reported. However, to date, there are few reports of translational co-regulation of multiple components of a developmental signaling pathway. Here, we show that an RNA
Jiawei Sun et al.
Development (Cambridge, England), 145(19) (2018-08-24)
Maternal mRNAs and proteins dictate early embryonic development before zygotic genome activation. In the absence of transcription, elaborate control of maternal mRNA translation is of particular importance for oocyte maturation and early embryogenesis. By analyzing zebrafish ybx1 mutants with a

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique