Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

WH0000142M1

Sigma-Aldrich

Monoclonal Anti-PARP1 antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

PARP1 Antibody - Monoclonal Anti-PARP1 antibody produced in mouse, Parp1 Antibody, Anti-ADPRT, Anti-ADPRT1, Anti-PARP, Anti-PARP1, Anti-PPOL, Anti-pADPRT1, Anti-poly (ADP-ribose) polymerase family, member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3G4, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PARP1(142)

Description générale

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein and belongs to the PARP family. This protein is made up of the N-terminal DNA-binding domain, central auto modification domain and C-terminal catalytic domain. PARP1 protein is located on the nucleoli. The PARP1 gene is located on the human chromosome at 1q42.12.

Immunogène

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Application

Monoclonal Anti-PARP1 antibody produced in mouse has been used in:
  • western blotting
  • indirect immunofluorescence
  • high-throughput cellular thermal shift assay (CESTA HT)

Actions biochimiques/physiologiques

Poly (ADP-ribose) polymerase 1 (PARP1) protein plays a role in DNA repair by catalyzing the polymerization of adenosine diphosphate (ADP)-ribose units. This protein also plays a role in the early response to DNA damage. Mutations in the PARP1 gene is associated with loss of cell viability.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Esin Orhan et al.
Cancer letters, 589, 216820-216820 (2024-04-05)
One in three Triple Negative Breast Cancer (TNBC) is Homologous Recombination Deficient (HRD) and susceptible to respond to PARP inhibitor (PARPi), however, resistance resulting from functional HR restoration is frequent. Thus, pharmacologic approaches that induce HRD are of interest. We
Yingbiao Ji et al.
Current opinion in genetics & development, 20(5), 512-518 (2010-07-02)
Cell growth and differentiation during developmental processes require the activation of many inducible genes. However, eukaryotic chromatin, which consists of DNA and histones, becomes a natural barrier impeding access to the functional transcription machinery. To break through the chromatin barrier
Michèle Rouleau et al.
Nature reviews. Cancer, 10(4), 293-301 (2010-03-05)
Recent findings have thrust poly(ADP-ribose) polymerases (PARPs) into the limelight as potential chemotherapeutic targets. To provide a framework for understanding these recent observations, we review what is known about the structures and functions of the family of PARP enzymes, and
Arnab Ray Chaudhuri et al.
Nature reviews. Molecular cell biology, 18(10), 610-621 (2017-07-06)
Cells are exposed to various endogenous and exogenous insults that induce DNA damage, which, if unrepaired, impairs genome integrity and leads to the development of various diseases, including cancer. Recent evidence has implicated poly(ADP-ribose) polymerase 1 (PARP1) in various DNA
Y Liu et al.
Cancer gene therapy, 24(5), 208-214 (2017-03-11)
Cisplatin resistance hinders the efficacy of chemotherapy in ovarian cancer. MicroRNAs (miRs) have been implicated in drug resistance in anti-cancer chemotherapy. We compared the expression profiles of miRs between cisplatin-resistant and cisplatin-sensitive ovarian cancer cells, and found that miR-216b was

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique