SAB1402692

Monoclonal Anti-APOC3, (C-terminal) antibody produced in mouse

clone 8H7, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : APOCIII, MGC150353
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 8H7, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~34.8 kDa
• Espèces réactives: human
• Technique(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_000040
• Numéro d'accès UniProt: P02656
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... APOC3(345)

Description

Description générale

Apolipoprotein C3 (APOC3) is a 79 amino acid protein with a molecular weight of 8.8kDa. It is present on high density, low density and triglyceride-rich lipoproteins. The gene encoding this protein is localized on human chromosome 11q23.3.

Immunogène

APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Actions biochimiques/physiologiques

Apolipoprotein C3 (APOC3) is involved in the metabolism of triglyceride-rich lipoproteins. It may have a role in atherosclerosis. The protein stimulates hypertriglyceridemia (HTG) by inhibiting the activity of lipoprotein lipase and interfering with the binding of APOB or APOE to hepatic receptors. It also promotes very low density lipoprotein (VLDL) assembly and secretion in the liver.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable