Accéder au contenu
Merck
Toutes les photos(2)

Documents

SAB1402361

Sigma-Aldrich

Monoclonal Anti-SOX10 antibody produced in mouse

clone 1E6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

DOM, MGC15649, WS2E, WS4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD03097283
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1E6, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~36.89 kDa

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

NM_006941

Numéro d'accès UniProt

P56693

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SOX10(6663)

Description générale

Anti-AURA Antibody detects endogenous levels of total AURA protein.
SOX10 (SRY-box 10) is a co-transcription factor that is located on human chromosome 22q13. SOX10 is temporarily expressed in melanoblasts.
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. (provided by RefSeq)

Immunogène

SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR

Actions biochimiques/physiologiques

SOX10 (SRY-box 10) regulates the expression of ErbB3 in neural crest cells. It is required for differentiation of peripheral glia. SOX10 plays an important role in the progression of melanocytes. Mutations in SOX10 result in Waardenburg syndrome and Hirschsprung disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The SOX10/Sox10 gene from human and mouse: sequence, expression, and transactivation by the encoded HMG domain transcription factor
Pusch C, et al.
Human Genetics, 103(2), 115-123 (1998)
The transcription factor Sox10 is a key regulator of peripheral glial development
Britsch S, et al.
Genes & Development, 15(1), 66-78 (2001)
Takuya E Kishimoto et al.
Veterinary pathology, 55(5), 634-644 (2018-06-02)
Oligodendroglioma is a common brain tumor in dogs, particularly brachycephalic breeds. Oligodendrocyte precursor cells (OPCs) are suspected to be a possible origin of oligodendroglioma, although it has not been well elucidated. In the present study, 27 cases of canine brain
Interaction among SOX10, PAX3 and MITF, three genes altered in Waardenburg syndrome
Bondurand N, et al.
Human Molecular Genetics, 9(13), 1907-1917 (2000)
SOX10-Nano-Lantern Reporter Human iPS Cells; A Versatile Tool for Neural Crest Research
Horikiri T, et al.
PLoS ONE (2017)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique