HPA010807

Anti-B4GALT1 antibody produced in rabbit

Ab2, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-β-1,4-GalTase 1 antibody produced in rabbit, Anti-β-1,4-Galactosyltransferase 1 antibody produced in rabbit, Anti-β4Gal-T1 antibody produced in rabbit, Anti-UDP-Gal:β-GlcNAc β-1,4-galactosyltransferase 1 antibody produced in rabbit, Anti-UDP-galactose:β-N-acetylglucosamine β-1,4-galactosyltransferase 1 antibody produced in rabbit, Anti-b4Gal-T1 antibody produced in rabbit
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA010807
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Séquence immunogène: LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM
• Numéro d'accès UniProt: P15291
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... B4GALT1(2683)

Description

Description générale

B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1 to GALT7. B4GALT1 has two isoforms, having different cellular locations, because of differences in their cytoplasmic domains. The long isoform is localized to the cell surface, whereas the short isoform is found in the Golgi apparatus. This gene is located on human chromosome 9p13, and codes for a protein containing 398 amino acids. It is expressed in most tissues, excluding adult brain and fetal heart and brain.

Immunogène

β-1,4-Galactosyltransferase 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-B4GALT1 antibody produced in rabbit has been used in immunofluorescence microscopyand immunoblotting.

Actions biochimiques/physiologiques

B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) is responsible for the synthesis of galactose β-1,4-N-acetylglucosamine (Galβ1-4GlcNAc) groups on glycoproteins, on their N-linked sugar chains. This is performed by the short isoform of B4GALT1, which resides in Golgi bodies. The long isoform, localized to the cell surface, helps in cell adhesion, by interacting with N-acetylglucosamine containing oligosaccharides, which are found in the extracellular matrix. In patients with rheumatoid arthritis, it is involved in the inflammatory response in the synovial tissue. B4GALT1 plays an important role in the proliferation of MCF-7 breast cancer cells by interacting with estrogen receptor. It is methylated and down-regulated in colorectal cancer patients, and hence, can act as a marker of invasive phenotype of colorectal cancer.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71676

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)