HPA009177

Anti-PIP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-GCDFP-15, Anti-Gross cystic disease fluid protein 15, Anti-Prolactin-induced protein, Anti-Prolactin-inducible protein precursor, Anti-SABP, Anti-Secretory actin-binding protein, Anti-gp17
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA009177
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
• Numéro d'accès UniProt: P12273
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PIP(5304)

Description

Description générale

PIP (prolactin-induced protein) is a secretd glycoprotein, which exists as a monomer. This protein is found in exocrine glands, gross cystic disease and breast cancers showing apocrine features. The corresponding gene is localized to human chromosome 7q34-q35. This protein is localized to cytoplasm and plasma membrane. PIP has a molecular weight of 14kDa and is a component of various body fluids including human tear fluid.

Immunogène

Prolactin-inducible protein precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-PIP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

PIP (prolactin-induced protein) gene is activated transcriptionally by androgen and by prolactin in a post-transcriptional manner. It is also regulated by lactogenic hormones produced by pituitary gland and other steroids. This protein is expressed in breast cancers and is linked with ER⁺ (estrogen receptor), PgR⁺ (progesterone receptor), low tumor grade and relapse-free survival. It is inactivated in advanced stages of tumor. The expression of this protein is up-regulated in keratoconus (KC), which is a bilateral degenerative disease of the cornea and is characterized by scarring, bulging of the cornea and thinning of stroma. PIP, therefore, might function as a biomarker for KC disease.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71608

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)