Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV53631

Sigma-Aldrich

Anti-NUP98 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-ADIR2, Anti-NUP196, Anti-Nucleoporin 98 kDa

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

98 kDa

Espèces réactives

horse, human, rabbit, bovine, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NUP98(4928)

Description générale

Nuclear pore complex protein is a protein encoded by the nucleoporin 98 kDa (NUP98) gene in humans. NUP98 gene encodes a peripheral membrane protein nucleoporin that belongs to nucleoporin GLFG family. This protein is formed from a precursor protein of 186 kDa that after cleavage yields two nucleoporins, Nup96 and Nup98. The nuclear import and export takes place through the nuclear pore complex (NPC), which is composed of unique proteins known as nucleoporins. The NUP98 gene of 122kb long, has 33 exons and is located on human chromosome 11p15.4.

Immunogène

Synthetic peptide directed towards the N terminal region of human NUP98

Application

Anti-NUP98 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

Nucleoporin 98 kDa (NUP98) functions as a docking protein for cytosol mediated docking of import substrates. During mitosis, NUP98 interacts with nucleocytoplasmic transport factors Rae1 and regulates the destruction of the securin protein by the anaphase-promoting complex (APC). Thus, Nucleoporins play an important function in nucleocytoplasmic transport, transcription and mitosis. Nuclear pore complex (NPC) also plays a role during nuclear processes such as chromatin silencing, transcriptional regulation and DNA damage repair. NUP98-Rae1 complex prevents aneuploidy. Overexpression of NUP98 along with other proteins and several associated nuclear export factors dysregulate signaling pathways and transcription resulting in alteration of nucleoporin functionality, which may cause cancer. NUP98 acts as an important predictor of anthracycline-based chemotherapy response in triple-negative breast cancer patients.

Séquence

Synthetic peptide located within the following region: EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Dan N Simon et al.
Advances in experimental medicine and biology, 773, 285-307 (2014-02-25)
The nuclear pore complex (NPC) mediates trafficking between the cytoplasm and nucleoplasm. It also plays key roles in other nuclear processes such as chromatin silencing, transcriptional regulation, and DNA damage repair. Nucleoporins, the structural components of the NPC, have been
Akiko Takeda et al.
Seminars in cancer biology, 27, 3-10 (2014-03-25)
Hematologic malignancies are often associated with chromosomal rearrangements that lead to the expression of chimeric fusion proteins. Rearrangements of the genes encoding two nucleoporins, NUP98 and NUP214, have been implicated in the pathogenesis of several types of hematologic malignancies, particularly
B M Fontoura et al.
The Journal of cell biology, 144(6), 1097-1112 (1999-03-24)
The mammalian nuclear pore complex (NPC) is comprised of approximately 50 unique proteins, collectively known as nucleoporins. Through fractionation of rat liver nuclei, we have isolated >30 potentially novel nucleoporins and have begun a systematic characterization of these proteins. Here
Y Arai et al.
Blood, 89(11), 3936-3944 (1997-06-01)
The inv(11)(p15q22) is a recurrent chromosomal abnormality associated with de novo and therapy-related myeloid malignancies. Here we report the molecular definition of this chromosomal aberration in four patients. Positional cloning showed the consistent rearrangement of the DDX10 gene on chromosome
Karthik B Jeganathan et al.
Nature, 438(7070), 1036-1039 (2005-12-16)
Cdc20 and Cdh1 are the activating subunits of the anaphase-promoting complex (APC), an E3 ubiquitin ligase that drives cells into anaphase by inducing degradation of cyclin B and the anaphase inhibitor securin. To prevent chromosome missegregation, APC activity directed against

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique