Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV47590

Sigma-Aldrich

Anti-SMC3 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-BAM, Anti-BMH, Anti-CDLS3, Anti-CSPG6, Anti-HCAP, Anti-SMC3L1, Anti-Structural maintenance of chromosomes 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

74 kDa

Espèces réactives

horse, bovine, rat, human, guinea pig, dog, mouse, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_005436

Numéro d'accès UniProt

Q9UQE7

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SMC3(9126)

Description générale

SMC3 codes for a part of the cohesion complex that regulates chromosome segregation during mitosis. It is known to form a heterodimer with SMC1, which subsequently can restructure the double helical form of DNA into a series of loops. Studies have reported that the opening of the Smc3-Scc1 gate is needed for removal of cohesion from chromosomes during prophase. However, in Drosophila, the disengagement of Smc3/kleisin interface releases cohesin from chromosomes during mitosis and interphase.
Rabbit Anti-SMC3 antibody recognizes human, mouse, rat, chicken, zebrafish, bovine, and canine SMC3.

Immunogène

Synthetic peptide directed towards the C terminal region of human SMC3

Application

Rabbit Anti-SMC3 antibody is suitable for western blot applications at a concentration of 0.25μg/ml. The product can also be used for IHC applications.

Actions biochimiques/physiologiques

SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.

Séquence

Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mingxuan Sun et al.
Nucleic acids research, 41(12), 6149-6160 (2013-04-27)
Cohesin plays a critical role in sister chromatid cohesion, double-stranded DNA break repair and regulation of gene expression. However, the mechanism of how cohesin directly interacts with DNA remains unclear. We report single-molecule experiments analyzing the interaction of the budding
Christian S Eichinger et al.
The EMBO journal, 32(5), 656-665 (2013-01-24)
Cohesin's Smc1, Smc3, and kleisin subunits create a tripartite ring within which sister DNAs are entrapped. Evidence suggests that DNA enters through a gate created by transient dissociation of the Smc1/3 interface. Release at the onset of anaphase is triggered
Johannes Buheitel et al.
The EMBO journal, 32(5), 666-676 (2013-01-31)
Faithful transmission of chromosomes during eukaryotic cell division requires sister chromatids to be paired from their generation in S phase until their separation in M phase. Cohesion is mediated by the cohesin complex, whose Smc1, Smc3 and Scc1 subunits form

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique