Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV46228

Sigma-Aldrich

Anti-PIP3-E (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-IPCEF1, Anti-KIAA0403, Anti-Phosphoinositide-binding protein PIP3-E, Anti-RP3-402L9.2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

49 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001124171

Numéro d'accès UniProt

Q8WWN9

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PIP3-E(26034)

Immunogène

Synthetic peptide directed towards the middle region of human PIP3-E

Application

Anti-PIP3-E (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Actions biochimiques/physiologiques

PIP3-E (Phosphoinositide-binding protein PIP3-E) also referred to as Interactor protein for cytohesin exchange factors 1 (IPCEF1) is a protein that binds to cytohesin 2 and augments its activity in cultured cells. This results in the nerve injury-induced membrane receptor trafficking in the dorsal root ganglions (DRGs) of adult rats under neuropathic pain conditions. Further, IPCEF1 produces a single protein that plays a crucial role in HGF-induced Arf6 activation and migration in response to HGF treatment.

Séquence

Synthetic peptide located within the following region: IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Myriam A Attar et al.
Experimental cell research, 318(3), 228-237 (2011-11-17)
Epithelial cells are largely immotile under normal circumstances, but become motile during development, repair of tissue damage and during cancer metastasis. Numerous growth factors act to initiate epithelial cell movements. Hepatocyte growth factor (HGF) induces many epithelial cell lines to
Xiang Zhang et al.
Journal of experimental & clinical cancer research : CR, 39(1), 190-190 (2020-09-18)
Insulin-like growth factor 2 (IGF2) messenger RNA binding protein 3 (IMP3) has been testified to be overexpressed in prostate cancer and strongly related to patients' poor prognosis. However, the functions of IMP3 and the underlying mechanisms in prostate cancer still
Xiaowei Guan et al.
Naunyn-Schmiedeberg's archives of pharmacology, 380(5), 459-463 (2009-09-17)
Interaction protein for cytohesin exchange factors 1 (IPCEF1) is a recently identified protein that binds to cytohesin 2 and might participate in membrane receptor trafficking by enhancing the activity of cytohesin 2 in cultured cells. However, whether IPCEF1 is involved

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique