AV43962

Anti-SLC25A39 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-CGI-69, Anti-CGI69, Anti-FLJ22407, Anti-Solute carrier family 25, member 39
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 39 kDa
• Espèces réactives: human, horse, rat, mouse, guinea pig, rabbit, bovine, dog
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_001137252
• Numéro d'accès UniProt: Q9BZJ4-2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SLC25A39(51629)

Description

Description générale

Solute carrier family 25, member 39 (SLC25A39, CGI69) is a member of the SLC25 carrier family that mediates transport across the inner mitochondrial membrane. SLC25A39 may be involve in the incorporation of iron into protoporphyrin IX, an essential step in heme biosynthesis.

Spécificité

Anti-SLC25A39 polyclonal antibody reacts with human, mouse, rat, canine, bovine, and zebrafish solute carrier family 25, member 39 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human SLC25A39

Application

Anti-SLC25A39 polyclonal antibody is used to tag solute carrier family 25, member 39 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 25, member 39 in mitochondrial transport in support of iron-dependent processes such as heme biosynthesis.

Actions biochimiques/physiologiques

SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Séquence

Synthetic peptide located within the following region: RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable