Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV13040

Sigma-Aldrich

Anti-GRIK4 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Glutamate receptor, ionotropic, kainate 4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

107 kDa

Espèces réactives

mouse, human, rabbit, dog, pig, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_055434

Numéro d'accès UniProt

Q16099

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GRIK4(2900)

Immunogène

Synthetic peptide directed towards the N terminal region of human GRIK4

Application

Anti-GRIK4 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

GRIK4 or glutamate receptor 4 receptor subunit modulates the synaptic transmission and cellular excitability in the brain. Mutations in GRIK4 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.

Séquence

Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Justin S Catches et al.
Behavioural brain research, 228(2), 406-414 (2011-12-29)
There is a clear link between dysregulation of glutamatergic signaling and mood disorders. Genetic variants in the glutamate receptor gene GRIK4, which encodes the kainate receptor subunit GluK4, alter the susceptibility for depression, bipolar disorder and schizophrenia. Here we demonstrate
Sonja Horstmann et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 35(3), 727-740 (2009-11-20)
Single-nucleotide polymorphisms (SNPs) in the FKBP5, GRIK4, and HTR2A genes have been shown to be associated with response to citalopram treatment in the STAR(*)D sample, but only associations with FKBP5 have so far been tested in the Munich Antidepressant Response

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique