Accéder au contenu
Merck
Toutes les photos(1)

Documents

374087

Sigma-Aldrich

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

liquid, clone HO-1-1, Calbiochem®

Synonyme(s) :

Anti-HO-1, Anti-Hsp32

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Forme d'anticorps

purified antibody

Type de produit anticorps

primary antibodies

Clone

HO-1-1, monoclonal

Forme

liquid

Contient

≤0.1% sodium azide as preservative

Espèces réactives

human, rat, canine, monkey, mouse, bovine

Fabricant/nom de marque

Calbiochem®

Conditions de stockage

OK to freeze
avoid repeated freeze/thaw cycles

Isotype

IgG1

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

bovine ... Hmox1(513221)
dog ... Hmox1(442987)
human ... HMOX1(3162)
mouse ... Hmox1(15368)
rat ... Hmox1(24451)
rhesus monkey ... Hmox1(719266)

Catégories apparentées

Description générale

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.

Immunogène

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (4 µg/ml, chemiluminescence)

Immunocytochemistry (1:1000)

Immunoprecipitation (20 µg/ml)

Conditionnement

Please refer to vial label for lot-specific concentration.

Avertissement

Toxicity: Standard Handling (A)

Forme physique

In PBS, 50% glycerol.

Reconstitution

Following initial thaw, aliquot and freeze (-20°C).

Autres remarques

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Informations légales

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Hai Lu et al.
Brain sciences, 14(5) (2024-05-25)
The discovery of novel diagnostic methods and therapies for Alzheimer's disease (AD) faces significant challenges. Previous research has shed light on the neuroprotective properties of Apelin-13 in neurodegenerative disorders. However, elucidating the mechanism underlying its efficacy in combating AD-related nerve
László Potor et al.
Oxidative medicine and cellular longevity, 2013, 676425-676425 (2013-06-15)
Oxidized cell-free hemoglobin (Hb), including covalently cross-linked Hb multimers, is present in advanced atherosclerotic lesions. Oxidation of Hb produces methemoglobin (Fe(3+)) and ferryl hemoglobin (Fe(4+) = O(2-)). Ferryl iron is unstable and can return to the Fe(3+) state by reacting
László Potor et al.
Oxidative medicine and cellular longevity, 2018, 3812568-3812568 (2018-03-22)
The infiltration of red blood cells into atheromatous plaques is implicated in atherogenesis. Inside the lesion, hemoglobin (Hb) is oxidized to ferri- and ferrylHb which exhibit prooxidant and proinflammatory activities. Cystathione gamma-lyase- (CSE-) derived H2S has been suggested to possess
Qian Sun et al.
Experimental and therapeutic medicine, 21(3), 190-190 (2021-01-26)
The nuclear erythroid 2-related factor 2 (NRF2)/antioxidant response element (ARE) pathway has been shown to provide strong protection against oxidative stress injury induced by renal ischemia-reperfusion (IR). However, the endogenous regulatory mechanism of the NRF2/ARE pathway in renal IR injury
Steven J T Jackson et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 60, 431-438 (2013-08-14)
Curcumin, a component of turmeric spice that imparts flavor and color to curry, is thought to possess anti-inflammatory and antioxidant properties in biological tissues. However, while such efficacies have been described in the context of carcinogenesis, the impact of curcumin
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique