Skip to Content
Merck
All Photos(7)

Key Documents

HPA015104

Sigma-Aldrich

Anti-MTDH antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-3D3/lyric antibody produced in rabbit, Anti-AEG-1 antibody produced in rabbit, Anti-Astrocyte elevated gene-1 protein antibody produced in rabbit, Anti-Lysine-rich CEACAM1 co-isolated protein antibody produced in rabbit, Anti-Metadherin antibody produced in rabbit, Anti-Metastasis adhesion protein antibody produced in rabbit, Anti-Protein LYRIC antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
conjugate:
unconjugated
application:
IF
IHC
clone:
polyclonal
species reactivity:
human
citations:
6
technique(s):
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MTDH(92140)

Looking for similar products? Visit Product Comparison Guide

General description

MTDH (metadherin) is a transmembrane protein, which spans the membrane once, and has a molecular weight of 64kDa. It is also called astrocyte elevated gene-1 (AEG-1) and lysine-rich CEACAM1 coisolated (LYRIC). It was initially isolated from primary human fetal astrocytes, as a transcript induced by human immunodeficiency virus (HIV)-1. This gene is localized to human chromosome 8q22.1, and is expressed in human brain, with higher expression in neurons as compared to glial cells. This gene has 12 exons and 11 introns.

Immunogen

Protein LYRIC recombinant protein epitope signature tag (PrEST)

Application

Anti-MTDH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

MTDH (metadherin) is highly expressed in multiple cancers such as, esophageal squamous cell carcinoma, hepatocellular carcinoma (HCC), breast, gastric, renal, prostate, colorectal cancer, non-small cell lung cancer, and glioma. It promotes angiogenesis, autophagy, tumor invasion and metastasis. It is responsible for resistance to chemotherapy and tamoxifen, and its up-regulation in invasive breast cancer is related to poor prognosis. In HER2+ breast cancer, it is responsible for resistance to trastuzumab. It chromosomal location is a susceptibility locus to migraine, and thus, this gene might be associated to migraine. It is up-regulated in astrocytomas, and higher the expression level, higher the grade of astrocytoma. Thus, this protein has potential as diagnostic and prognostic marker for astrocytomas. It is essential for the tumorigenesis of hepatocellular carcinoma (HCC), via the activation of NF-κB.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72055

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zhangxiu He et al.
International journal of clinical and experimental pathology, 7(8), 5038-5044 (2014-09-10)
Astrocyte Elevated Gene-1 (AEG-1) has been proposed as a biomarker for a variety of cancers. This study aimed to investigate the expression of AEG-1 in human astrocytomas and the correlation between AEG-1 expression and clinicopathologic variables of astrocytomas. AEG-1 expression
Cheng Du et al.
BMC cancer, 14, 869-869 (2014-11-25)
Trastuzumab resistance is almost inevitable in the management of human epidermal growth factor receptor (HER) 2 positive breast cancer, in which phosphatase and tensin homolog deleted from chromosome 10 (PTEN) loss is implicated. Since metadherin (MTDH) promotes malignant phenotype of
Ioanna Giopanou et al.
BioMed research international, 2014, 178410-178410 (2014-06-26)
NF-κB signaling promotes cancer progression in a large number of malignancies. Metadherin, a coactivator of the NF-κB transcription complex, was recently identified to regulate different signaling pathways that are closely related to cancer. We assessed the immunohistochemical expression of p50
Chadia L Robertson et al.
Cancer research, 74(21), 6184-6193 (2014-09-07)
Activation of the oncogene AEG-1 (MTDH, LYRIC) has been implicated recently in the development of hepatocellular carcinoma (HCC). In mice, HCC can be initiated by exposure to the carcinogen DEN, which has been shown to rely upon activation of NF-κB
Yuka Isozaki et al.
International journal of oncology, 41(3), 985-994 (2012-07-04)
The aim of this study was to determine whether histone acetylation regulates tumor suppressive microRNAs (miRNAs) in esophageal squamous cell carcinoma (ESCC) and to identify genes which are regulated by these miRNAs. We identified a miRNA that was highly upregulated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service