WH0008521M3

Monoclonal Anti-GCM1 antibody produced in mouse

clone 3G7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-GCMA, Anti-glial cells missing homolog 1 (Drosophila), Anti-hGCMa
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G7, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• GenBank accession no.: NM_003643
• UniProt accession no.: Q9NP62
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GCM1(8521)

Description

General description

The gene GCM1 (glial cells missing homolog 1) is mapped to human chromosome 6p12. It belongs to the glial cells missing (GCM) family. GCM1 is present in villous cytotrophoblast cells, the syncytiotrophoblast layer and extravillous trophoblast cells.

Immunogen

GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*

Biochem/physiol Actions

GCM1 (glial cells missing homolog 1) is a transcription factor that is specific for placenta. It plays an important role in trophoblast cell fusion and invasion by enhancing the expression of syncytin-1 and syncytin-2 fusogenic proteins and high-temperature requirement protein A4 (HtrA4), a serine protease. Disruption in the activity of this gene can result in defective placental development, thereby leading to embryonic death.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves