SAB1402417

Monoclonal Anti-FZD7 antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FzE3
• MDL number: MFCD06798447
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4D9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37 kDa
• species reactivity: human
• technique(s): ELISA: suitable; capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_003507
• UniProt accession no.: O75084
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FZD7(8324)

Description

General description

Frizzled class receptor 7 (FZD7) is an oncogene involved in various malignancies. It is a receptor of Wingless (WNT) proteins. The protein possesses seven hydrophobic domains. The gene encoding FZD7 is localized on human chromosome 2q33.1.

Immunogen

FZD7 (NP_003498.1, 155 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA

Biochem/physiol Actions

Frizzled class receptor 7 (FZD7) modulates sensitivity to chemotherapeutic drugs. It functions in tumor initiation in melanoma cells. The protein acts as a mediator in canonical and non-canonical Wnt signaling pathways.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable