SAB1401302

Monoclonal Anti-PREP antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC16060, PE, PEP
• MDL number: MFCD00151733
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2D7, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): capture ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: NM_002726
• UniProt accession no.: P48147
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PREP(5550)

Description

General description

The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. (provided by RefSeq)

Immunogen

PREP (NP_002717.3, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable