Skip to Content
Merck
All Photos(7)

Documents

HPA045910

Sigma-Aldrich

Anti-CRBN antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-MRT2, Anti-MRT2A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CRBN(51185)

General description

The gene CRBN (cereblon) is mapped to human chromosome 3p26.2. It is strongly expressed in the brain. The encoded protein has a conserved Lon (ATP-dependent protease La) domain. The CRBN protein is present in the cytoplasm and nucleus.
CRBN protein interacts with:

Immunogen

cereblon recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CRBN antibody produced in rabbit has been used in western blotting.
Anti-CRBN antibody produced in rabbit has been used in immunohistochemistry

Biochem/physiol Actions

CRBN (cereblon) mainly recruits substrates for E3 ubiquitin ligase. It interacts with BKCa (calcium-activated potassium channel subunit α-1), ClC-2 (chloride channel protein 2), AMPK (5′-AMP-activated protein kinase), PSMB4 (proteasome subunit β 4), ikaros (IKZF1), aiolos (IKZF3) and MEIS2 (Meis1-related protein). These interactions might be required for sending the proteins for ubiquitination by the E3 ubiquitin ligase. Degradation of IKZF1 (ikaros family zinc finger protein 1) and IKZF3 by lenalidomide (immunomodulatory drug)-bound CRBN helps in anti-myeloma effect of lenalidomide. Similarly, treatment with thalidomide in CRBN positive cells is effective in elderly patients with multiple myeloma. CRBN might also be associated with autosomal recessive nonsyndromic intellectual disability.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79292

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cereblon inhibits proteasome activity by binding to the 20S core proteasome subunit beta type 4.
Lee KM, et al.
Biochemical and Biophysical Research Communications, 427, 618-618 (2012)
Measuring cereblon as a biomarker of response or resistance to lenalidomide and pomalidomide requires use of standardized reagents and understanding of gene complexity.
Gandhi AK, et al.
British Journal of Haematology, 164, 233-244 (2014)
Qinqin Xu et al.
BMC cancer, 16, 297-297 (2016-05-05)
Immunomodulatory drugs (IMiDs), such as lenalidomide, are therapeutically active compounds that bind and modulate the E3 ubiquitin ligase substrate recruiter cereblon, thereby affect steady-state levels of cereblon and cereblon binding partners, such as ikaros and aiolos, and induce many cellular
Microduplications of 3p26.3p26.2 containing CRBN gene in patients with intellectual disability and behavior abnormalities.
Papuc SM, et al.
European Journal of Medical Genetics, 58, 319-323 (2015)
Immunomodulatory drugs target IKZF1-IRF4-MYC axis in primary effusion lymphoma in a cereblon-dependent manner and display synergistic cytotoxicity with BRD4 inhibitors.
Gopalakrishnan R, et al.
Oncogene, 35, 1797-1810 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service