Skip to Content
Merck
All Photos(1)

Key Documents

AV32279

Sigma-Aldrich

Anti-TFEC antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Tfec Antibody, Tfec Antibody - Anti-TFEC antibody produced in rabbit, Anti-TCFEC, Anti-TFECL, Anti-Transcription factor EC

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

35 kDa

species reactivity

human, rat, pig, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_036384

UniProt accession no.

Q5H9U8

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TFEC(22797)

General description

TFEC is a basic helix-loop-helix protein that forms heterodimers with TFE3 and subsequently blocks transcriptional stimulation. TFEC may be involved in the regulation of macrophage-specific genes.
Rabbit Anti-TFEC antibody recognizes mouse, canine, bovine, rat, and human TFEC.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFEC

Application

Rabbit Anti-TFEC antibody can be used for western blot applications at a concentration of 0.25μg/ml.

Biochem/physiol Actions

TFEC is an activator of transcription with two separate activation domains.

Sequence

Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nur P Damayanti et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 24(23), 5977-5989 (2018-08-01)
Translocation renal cell carcinoma (tRCC) represents a rare subtype of kidney cancer associated with various TFE3, TFEB, or MITF gene fusions that are not responsive to standard treatments for RCC. Therefore, the identification of new therapeutic targets represents an unmet
G Q Zhao et al.
Molecular and cellular biology, 13(8), 4505-4512 (1993-08-01)
We have identified a new basic helix-loop-helix (BHLH) DNA-binding protein, designated TFEC, which is closely related to TFE3 and TFEB. The basic domain of TFEC is identical to the basic DNA-binding domain of TFE3 and TFEB, whereas the helix-loop-helix motif
M Rehli et al.
Journal of immunology (Baltimore, Md. : 1950), 162(3), 1559-1565 (1999-02-11)
The murine homologue of the TFEC was cloned as part of an analysis of the expression of the microphthalmia-TFE (MiT) subfamily of transcription factors in macrophages. TFEC, which most likely acts as a transcriptional repressor in heterodimers with other MiT

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service