Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV38073

Sigma-Aldrich

Anti-RUNX1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Runt-elated transcription factor 1 (acute myeloid leukemia 1; aml1 oncogene)

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

12 kDa

species reactivity

mouse, bovine, guinea pig, dog, rabbit, human, rat, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_001001890

UniProt accession no.

Q01196

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RUNX1(861)

General description

Runt-related transcription factor 1 (RUNX1) is a transcription factor that plays an important role in hematopoiesis, osteogenesis and neurogenesis. It is a member of Runt-related transcription factors (RUNXs). It was first identified as a component of Polyomavirus enhancer binding protein 2 (PEBP2) and Moloney murine leukemia virus enhancer core binding factor (CBF). Three isoforms of the protein have been identified: RUNX1a, RUNX1b and RUNX1c. Structurally, it consists of Runt domain at the N-terminal region.

Immunogen

Synthetic peptide directed towards the N terminal region of human RUNX1

Application

Anti-RUNX1 antibody produced in rabbit is suitable for western blot.

Biochem/physiol Actions

RUNX1 (Runt-related transcription factor 1) plays a vital role in tumour suppression and oncogenic activities. In hematopoiesis, it is involved in hematopoietic development, hematopoietic stem cell homeostasis, and various blood malignancies. It may have clinicopathological impact on the proliferation of human bone marrow cells used in transplantation therapy.

Sequence

Synthetic peptide located within the following region: KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qingliang Zheng et al.
Journal of immunology (Baltimore, Md. : 1950), 196(3), 1317-1326 (2015-12-25)
Upon recognition of viral components by pattern recognition receptors, including TLRs and retinoic acid-inducible gene I-like helicases, cells are activated to produce type I IFN, which plays key roles in host antiviral innate immune response. However, excessive IFN production may
Nicola Ferrari et al.
PloS one, 9(6), e100759-e100759 (2014-06-27)
The RUNX1 transcription factor is widely recognised for its tumour suppressor effects in leukaemia. Recently a putative link to breast cancer has started to emerge, however the function of RUNX1 in breast cancer is still unknown. To investigate if RUNX1
Kentson Lam et al.
Frontiers in bioscience (Landmark edition), 17, 1120-1139 (2011-12-29)
RUNX1 is a transcription factor that regulates critical processes in many aspects of hematopoiesis. RUNX1 is also integral in defining the definitive hematopoietic stem cell. In addition, many hematological diseases like myelodysplastic syndrome and myeloproliferative neoplasms have been associated with

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service