Synthetic peptide directed towards the N terminal region of human CBX4
Application
Anti-CBX4 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions
CBX4 belongs to the Polycomb group of proteins that are involved in determining stem cell pluripotency, identity and epigenetic gene silencing. CBX4 exhibits E3 sumo ligase activity that is directly involved in DNA damage response pathway. It interacts with p63 and regulates the transcription of genes that maintain the stemness of epithelial progenitors. CBX4 has a non-redundant role in T-cell proliferation and thymic organogenesis.
Sequence
Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Polycomb group (PcG) proteins are involved in epigenetic silencing where they function as major determinants of cell identity, stem cell pluripotency and the epigenetic gene silencing involved in cancer development. Recently numerous PcG proteins, including CBX4, have been shown to
Development (Cambridge, England), 140(4), 780-788 (2013-01-31)
Thymic epithelial cells (TECs) are the main component of the thymic stroma, which supports T-cell proliferation and repertoire selection. Here, we demonstrate that Cbx4, a Polycomb protein that is highly expressed in the thymic epithelium, has an essential and non-redundant
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.