Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

HPA031700

Sigma-Aldrich

Anti-MB21D1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-C6orf150

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

The gene MB21D1 (Mab-21 domain containing 1) is mapped to human chromosome 6q13. It is ubiquitously expressed.

Immunogen

Uncharacterized protein C6orf150 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MB21D1 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

MB21D1 (Mab-21 domain containing 1) is a cytosolic DNA sensor and is responsible for the immune activation. It is needed for interferon production via the STING (stimulator of interferon genes) pathway. DNA recognition by MB21D1 results in formation of 2′3′-cGAMP (cyclic guanosine monophosphate–adenosine monophosphate) which interacts with STING. These events lead to the activation of TBK1 (TANK-binding kinase 1), followed by activation of transcription factor IRF3 (interferon regulatory factor 3). MB21D1 also plays an important role in activation of interferons in presence of DNA virus (herpes simplex virus 1, vaccinia virus, adenovirus and retroviruses) infection. It is needed for the detection of Mycobacterium tuberculosis infection by macrophages and works as an innate immune sensor.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77652

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Genomic markers of ovarian reserve.
Wood MA and Rajkovic A
Seminars in Reproductive Medicine, 31, 399-415 (2013)
Pan-viral specificity of IFN-induced genes reveals new roles for cGAS in innate immunity.
Schoggins JW, et al.
Nature, 505, 691-695 (2014)
Cyclic GMP-AMP Synthase Is Required for Cell Proliferation and Inflammatory Responses in Rheumatoid Arthritis Synoviocytes.
Wang Y, et al.
Mediators of Inflammation, 2015, 192329-192329 (2015)
Knockout of cGAS and STING Rescues Virus Infection of Plasmid DNA-Transfected Cells.
Langereis MA, et al.
Journal of Virology, 89, 11169-11173 (2015)
Inhibition of cGAS DNA Sensing by a Herpesvirus Virion Protein.
Wu JJ, et al.
Cell host & microbe, 18, 333-344 (2015)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico