Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV31648

Sigma-Aldrich

Anti-LASS3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-LAG1 homolog, ceramide synthase 3 (S. cerevisiae)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

46 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... LASS3(204219)

Categorías relacionadas

Descripción general

Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid protein.
Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human LASS3

Aplicación

Rabbit Anti-LASS3 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

The gene encoding the hypothetical protein LASS3 is located on chromosome 15.

Secuencia

Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Yukiko Mizutani et al.
The Biochemical journal, 398(3), 531-538 (2006-06-07)
The LASS (longevity assurance homologue) family members are highly conserved from yeasts to mammals. Five mouse and human LASS family members, namely LASS1, LASS2, LASS4, LASS5 and LASS6, have been identified and characterized. In the present study we cloned two

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico