Skip to Content
Merck
All Photos(2)

Key Documents

HPA005483

Sigma-Aldrich

Anti-SH2B3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Lymphocyte adapter protein antibody produced in rabbit, Anti-Lymphocyte-specific adapter protein Lnk antibody produced in rabbit, Anti-SH2B adapter protein 3 antibody produced in rabbit, Anti-Signal transduction protein Lnk antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL

immunogen sequence

FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SH2B3(10019)

General description

SH2B3 (SH2B adaptor protein 3) is a part of adaptor family of proteins, which are characterized by a conserved tyrosine residue at the C-terminal, an Src homology-2 domain (SH2), a pleckstrin homology domain (PH) and a proline-rich dimerization domain at the N-terminal. It is majorly expressed in hematopoietic tissues and is a membrane bound protein. SH2B3 gene is located on chromosome 12q24, spans 46kbp, contains 9 exons, and encodes for a protein of 575 amino acids.

Immunogen

SH2B adapter protein 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SH2B3 (SH2B adaptor protein 3) binds to JAK2 and cytokine receptors, via its SH2 domain and inhibits downstream signaling pathway. By interacting with JAK2, it regulates erythropoietin (EPO) and thrombopoietin signaling, and also inhibits STAT pathway. Mutations in this gene are linked with idiopathic erythrocytosis, and mutations in exon 2 are associated with unexplained erythrocytosis, and below normal EPO levels. Different forms of myeloproliferative neoplasms (MPNs), such as primary myelofibrosis (PMF), JAK2V617F-negative erythrocytosis, and blast-phase or chronic MPNs, are associated with various mutations in SH2B3 gene. Studies also show a link between this gene and autoimmune diseases. Coeliac disease is associated with SNP rs3184504 in SH2B3 gene, and there is an increase in the expression of this protein in the intestinal mucosa of coeliac disease patients. There is also a link between SH2B3 and systemic lupus erythematosus, rheumatoid arthritis and thrombophilia.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86499

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Infrequent occurrence of mutations in the PH domain of LNK in patients with JAK2 mutation-negative 'idiopathic' erythrocytosis.
Ambra Spolverini et al.
Haematologica, 98(9), e101-e102 (2013-07-03)
Georg Auburger et al.
World journal of diabetes, 5(3), 316-327 (2014-06-18)
Genetic linkage analyses, genome-wide association studies of single nucleotide polymorphisms, copy number variation surveys, and mutation screenings found the human chromosomal 12q24 locus, with the genes SH2B3 and ATXN2 in its core, to be associated with an exceptionally wide spectrum
El-Sayed H Ibrahim et al.
JACC. CardioOncology, 3(1), 113-130 (2021-04-30)
Over half of all cancer patients receive radiation therapy (RT). However, radiation exposure to the heart can cause cardiotoxicity. Nevertheless, there is a paucity of data on RT-induced cardiac damage, with limited understanding of safe regional RT doses, early detection
A nonsynonymous LNK polymorphism associated with idiopathic erythrocytosis.
Mary Frances McMullin et al.
American journal of hematology, 86(11), 962-964 (2011-10-13)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service