WH0003280M1
Monoclonal Anti-HES1 antibody produced in mouse
clone 4D9, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-FLJ20408, Anti-HES1, Anti-HHL, Anti-HRY, Anti-hairy and enhancer of split 1, (Drosophila)
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4D9, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HES1(3280)
General description
Hairy and enhancer of split-1 (HES1) is a transcriptional repressor. It is a member of the basic helix-loop-helix family of transcription factors. This gene is mapped to human chromosome 3q29.
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. (provided by RefSeq)
Immunogen
HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
Application
Monoclonal Anti-HES1 antibody has been used in western blotting.
Biochem/physiol Actions
Hairy and enhancer of split-1 (HES1) is required for regulating NPC (neural progenitor cells) fate and fetal brain development. This gene also helps to maintain the undifferentiated and proliferative status of NPCs. Absence of HES1 is linked with poor prognosis in colorectal adenocarcinoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
HES1 promotes extracellular matrix protein expression and inhibits proliferation and migration in human trabecular meshwork cells under oxidative stress
Oncotarget, 8(13), 21818-21833 (2017)
Loss of Hes1 expression is associated with poor prognosis in colorectal adenocarcinoma
Human Pathology (2016)
[Identification of a novel deletion region in 3q29 microdeletion syndrome by oligonucleotide array comparative genomic hybridization]
The Korean Journal of Laboratory Medicine, 30(1), 70-75 (2010)
Human cytomegalovirus IE1 downregulates Hes1 in neural progenitor cells as a potential E3 ubiquitin ligase
PLoS Pathogens (2017)
Anti-correlation between longevity gene SirT1 and Notch signaling in ascending aorta biopsies from patients with bicuspid aortic valve disease
Heart and Vessels, 28(2), 268-275 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service