Skip to Content
Merck
All Photos(2)

Key Documents

AV100878

Sigma-Aldrich

Anti-TFAP2A antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Transcription factor AP-2 α (activating enhancer binding protein 2 α)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TFAP2A(7020)

Immunogen

Synthetic peptide directed towards the C terminal region of human TFAP2A

Application

Anti-TFAP2A antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

TFAP2A is a transcription factor that has both activator and repressor activities. The genes regulated by TFAP2A are involved in cell-type-specific proliferation and differentiation during embryonic development. Anomalies of TFAP2A have been observed in branchiooculofacial syndrome. Abnormalities in TFAP2A protein contribute to abnormal maturation in placenta in high-risk pregnancies.

Sequence

Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rachel M Sheridan et al.
Human pathology, 43(11), 1866-1874 (2012-05-12)
Recent studies from our laboratory have indicated that the transcription factor activator protein-2α plays a critical role in the differentiation of human villous cytotrophoblast cells to syncytiotrophoblast cells. However, little is known about the expression of activator protein-2α in placentas
Dawid Eckert et al.
Genome biology, 6(13), 246-246 (2006-01-20)
The AP-2 family of transcription factors consists of five different proteins in humans and mice: AP-2alpha, AP-2beta, AP-2gamma, AP-2delta and AP-2epsilon. Frogs and fish have known orthologs of some but not all of these proteins, and homologs of the family
Alina V Dumitrescu et al.
Ophthalmic genetics, 33(2), 100-106 (2011-12-24)
Branchio-Oculo-Facial syndrome (BOFS) is a rare, autosomal dominant developmental disorder that has a distinct phenotype with characteristic craniofacial abnormalities. We report a family with extensive ocular manifestations of BOFS caused by a novel mutation in the transcription factor AP-2 alpha

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service