WH0389692M1

Monoclonal Anti-MAFA antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-RIPE3b1, Anti-hMafA, Anti-v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian)
• MDL number: MFCD03455547
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2F1, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_201589
• UniProt accession no.: Q8NHW3
• shipped in: dry ice
• Storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MAFA(389692)

Descripción

General description

MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS; MIM 176730) (Olbrot et al., 2002 [PubMed 12011435]).[supplied by OMIM

Immunogen

MAFA (NP_963883, 222 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL

Biochem/physiol Actions

MAF bZIP transcription factor A (MAFA) modulates genes which are involved in pancreatic β-cell function and the protein itself is critical for the functioning of β-cells. It functions as a regulator to enhance the expression of genes which have a role in glucose-induced insulin secretion.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)