Saltar al contenido
MilliporeSigma
Todas las fotos(5)

Documentos clave

WH0057492M1

Sigma-Aldrich

Monoclonal Anti-ARID1B antibody produced in mouse

clone 2D2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-6A35, Anti-AT rich interactive domain 1B (SWI1-like), Anti-BAF250b, Anti-DAN15, Anti-ELD/OSA1, Anti-KIAA1235, Anti-p250R

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
$541.00

$541.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μG
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2D2, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2bκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ARID1B(57492)

Descripción general

AT-rich interaction domain 1B (ARID1B) is a member of SWItch/sucrose nonfermentable (SWI/SNF) chromatin remodelling complex. ARID1B gene is located on human chromosome 6q25.3.

Inmunógeno

ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR

Acciones bioquímicas o fisiológicas

AT-rich interaction domain 1B (ARID1B) is involved in the regulation of transcription and multiple downstream cellular processes. ARID1B acts as a coactivator of cell cycle genes. ARID1B acts as tumor suppressor in pancreatic cancer cell line. Mutations in ARID1B might be associated with Coffin-Siris syndrome (CSS).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

nwg

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A novel microduplication of ARID1B: Clinical, genetic, and proteomic findings
Seabra C, et al.
American Journal of Medical Genetics. Part A, 173(9), 2478-2484 (2017)
Corpus callosum abnormalities, intellectual disability, speech impairment, and autism in patients with haploinsufficiency of ARID1B
Halgren, et al.
Clinical Genetics, 82(3), 248-255 (2012)
ARID1B, a member of the human SWI/SNF chromatin remodeling complex, exhibits tumour-suppressor activities in pancreatic cancer cell lines
Khurshee et al.
British Journal of Cancer, 108(10), 2056-2056 (2013)
Mutations in SWI/SNF chromatin remodeling complex gene ARID1B cause Coffin-Siris syndrome
Santen G,et al.
Nature Genetics, 44(4), 379-379 (2012)
Dynamics of expression of ARID1A and ARID1B subunits in mouse embryos and in cells during the cell cycle
Flores-A, et al.
Cell and Tissue Research, 345(1), 137-148 (2011)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico