Saltar al contenido
MilliporeSigma
Todas las fotos(6)

Documentos clave

WH0051435M1

Sigma-Aldrich

Monoclonal Anti-SCARA3 antibody produced in mouse

clone 3A2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-APC7, Anti-CSR, Anti-CSR1, Anti-MSLR1, Anti-MSRL1, Anti-scavenger receptor class A, member 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3A2, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

rat, human, mouse

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SCARA3(51435)

Descripción general

This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. (provided by RefSeq)

Inmunógeno

SCARA3 (NP_057324, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE

Acciones bioquímicas o fisiológicas

Scavenger receptor class A member 3 (SCARA3) protects cells against ultraviolet (UV) irradiation and oxidative stress. Reduced expression of SCARA3 increases oxidative stress in keratoconus (KC) cells in vitro. Quantitative polymerase chain reaction (PCR) analysis proves that SCARA3 transcript is highly expressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared to breast carcinoma effusions. SCARA3 represses tumor growth and metastasis of prostate cancer. Therefore, it can be used as a potential therapeutic target for treating aggressive types of prostate cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

nwg

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Charles O Brown et al.
Leukemia research, 37(8), 963-969 (2013-03-30)
This study evaluates the role of scavenger receptor class A member 3 (SCARA3) in multiple myeloma (MM). SCARA3 expression was induced upon treatment with oxidative stressors (ionizing radiation and chemotherapeutic drugs). An epigenetic inactivation of SCARA3 was noted in MM.1S
Downregulation of SCARA3, CPSF3 and FOXM1 in Keratoconus Cells in vitro
CM Kenney
Investigative Ophthalmology & Visual Science, 53, 1112-1112 (2012)
Guoying Yu et al.
The American journal of pathology, 168(2), 597-607 (2006-01-27)
Prostate cancer is frequent among men over 45 years of age, but it generally only becomes lethal with metastasis. In this study, we identified a gene called cellular stress response 1 (CSR1) that was frequently down-regulated and methylated in prostate
H J Han et al.
Human molecular genetics, 7(6), 1039-1046 (1998-06-13)
Oxidative stress is a pathogenic condition that causes cellular damage and, in a normally functioning cell, several transcription factors respond to this threat by modulating expression of genes whose products ameliorate the altered redox status in some way. We have
Annika J Bock et al.
Human pathology, 43(5), 669-674 (2011-08-23)
Scavenger receptor class A, member 3 (SCARA3) was previously found to be overexpressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared with breast carcinoma effusions by global gene expression analysis. The present study aimed to validate this finding applying quantitative PCR and

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico