WH0023057M1

Monoclonal Anti-NMNAT2 antibody produced in mouse

clone 2E4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Nmnat2 Antibody, Nmnat2 Antibody - Monoclonal Anti-NMNAT2 antibody produced in mouse, Anti-C1orf15, Anti-KIAA0479, Anti-MGC2756, Anti-PNAT2, Anti-nicotinamide nucleotide adenylyltransferase 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2E4, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: NM_015039
• Nº de acceso UniProt: Q9BZQ4
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NMNAT2(23057)

Descripción

Descripción general

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2) is a rate limiting enzyme that is located on human chromosome 1q25. It is expressed in the brain. Nmnat2 is located to vesicular structures.

This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

NMNAT2 (NP_055854, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG

Aplicación

Monoclonal Anti-NMNAT2 antibody has been used in immunoblotting.

Acciones bioquímicas o fisiológicas

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2) plays a major role in cancer suppression. It may induce multiplication and prevent apoptosis in CRC (colorectal cancer) cells. NMNAT2 participates in energy metabolism. This protein helps to postpone axon degeneration.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)