WH0004780M1

Monoclonal Anti-NFE2L2 antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-NRF2, Anti-nuclear factor (erythroid-derived 2)-like 2
• UNSPSC Code: 12352203

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1F3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: suitable
• isotype: IgG2bκ
• immunogen sequence: FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA (without GST)
• UniProt accession no.: Q16236
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NFE2L2(4780)

Descripción

Immunogen

NFE2L2 (AAH11558, a.a. 71-170) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)