WH0004240M9

Monoclonal Anti-MFGE8 antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-BA46, Anti-EDIL1, Anti-HsT19888, Anti-OAcGD3S, Anti-milk fat globule-EGF factor 8 protein
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3E9, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso GenBank: NM_005928
• Nº de acceso UniProt: Q08431
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MFGE8(4240)

Descripción

Descripción general

Milk fat globule epidermal growth factor 8 (Mfge8) is a peripheral membrane soluble glycoprotein. It is liberated by several cells like macrophages. This protein is also termed as a phagocytosis “eat me” signal. It is predominantly expressed in lactating mammary glands.MFG-E8 has two-repeated EGF-like domains, a mucin-like domain, two-repeated discoidin-like domains (C-domains) and an integrin-binding motif (RGD sequence) in the EGF-like domain. This gene is located on human chromosome 15q26.

Inmunógeno

MFGE8 (NP_005919, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD

Acciones bioquímicas o fisiológicas

Milk fat globule epidermal growth factor 8 (Mfge8) controls inflammation and immunity by mediating apoptotic cell clearance. It plays an important role in autoimmunity, neoangiogenesis and sperm-egg binding. Mfge8 also plays a major role in membrane vesicle secretion like budding or shedding of plasma membrane (microvesicles) and exocytosis of endocytic multivesicular bodies (exosomes).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)