Saltar al contenido
MilliporeSigma
Todas las fotos(4)

Documentos clave

WH0003340M1

Sigma-Aldrich

Monoclonal Anti-NDST1 antibody produced in mouse

clone 1G10, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-HSST, Anti-N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, Anti-NST1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
$541.00

$541.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μG
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1G10, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NDST1(3340)

Descripción general

NDST1 (N-deacetylase and N-sulfotransferase 1) is a bifunctional enzyme that has both N-deacetylase and N-sulfotransferase activities. This gene is located on human chromosome 5q33.

Inmunógeno

NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI

Acciones bioquímicas o fisiológicas

The enzyme coded by NDST1 (N-deacetylase and N-sulfotransferase 1) gene participates in the first step in the production of heparan sulfate chains and proteoglycans. This enzyme also plays a major role in generating the GlcNS (N-sulfo glucosamine) residues.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A girl with developmental delay, ataxia, cranial nerve palsies, severe respiratory problems in infancy-Expanding NDST1 syndrome
Armstrong L, et al.
American Journal of Medical Genetics. Part A (2017)
WT1 mutation and 11P15 loss of heterozygosity predict relapse in very low-risk wilms tumors treated with surgery alone: a children's oncology group study
Perlman EJ, et al.
Journal of Clinical Oncology, 29(6), 698-703 (2011)
Role of Deacetylase Activity of N-Deacetylase/N-Sulfotransferase 1 in Forming N-Sulfated Domain in Heparan Sulfate
Dou W, et al.
The Journal of Biological Chemistry, 290(33), 20427-20437 (2015)

Artículos

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico