Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

WH0002515M1

Sigma-Aldrich

Monoclonal Anti-ADAM2 antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-FTNB, Anti-PH30, Anti-PH30b, Anti-a disintegrin and metalloproteinase domain 2 (fertilin beta)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
$406.00

$406.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μG
$406.00

About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

$406.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4A2, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ADAM2(2515)

Descripción general

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. (provided by RefSeq)

Inmunógeno

ADAM2 (NP_001455, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH

Acciones bioquímicas o fisiológicas

ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is an integrin binding protein. Absence of ADAM2 in mice causes defects in sperm-egg binding. In addition, it helps in transfer of sperm from the uterus into the oviduct.

Características y beneficios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ulyana V Desiderio et al.
PloS one, 5(10), e13744-e13744 (2010-11-10)
Integrins are heterodimeric cell adhesion molecules, with 18 α (ITGA) and eight β (ITGB) subunits forming 24 heterodimers classified into five families. Certain integrins, especially the α(4)/α(9) (ITGA4/ITGA9) family, interact with members of the ADAM (a disintegrin and metalloprotease) family.
Charles Gyamera-Acheampong et al.
Fertility and sterility, 93(4), 1112-1123 (2009-04-04)
To study the molecular basis for the accelerated capacitation rate in PCSK4-null sperm. Comparative and controlled experimental research study. Academic medical institute. Male mice C57BL/6J wild-type or null congenics for the Pcsk4 allele. Cauda and epididymal sperm were capacitated for

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico