WH0002027M1

Monoclonal Anti-ENO3 antibody produced in mouse

clone 5D1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-MSE, Anti-enolase 3 (beta, muscle)
• Número MDL: MFCD02262581
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 5D1, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso GenBank: NM_001976
• Nº de acceso UniProt: P13929
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... ENO3(2027)

Descripción

Descripción general

ENO3 (enolase 3) gene codes for enolase enzyme. This isoenzyme is present in skeletal and cardiac muscle cells. This gene is located on human chromosome 17pter-p11 b.

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR. (provided by RefSeq)

Inmunógeno

ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Acciones bioquímicas o fisiológicas

Mutations in ENO3 (enolase 3) is linked with metabolic myopathies that may occur due to decreased stability of the enzyme. It catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate. ENO3 possess several methylation properties.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)