The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
SRP0158
Histone H3 (2-58) human
recombinant, expressed in E. coli, ≥70% (SDS-PAGE)
Sinónimos:
HIST1H3E, Histone H3.1
Seleccione un Tamaño
$498.60
Precio de catálogo$554.00Ahorre 10 %Seleccione un Tamaño
About This Item
$498.60
Precio de catálogo$554.00Ahorre 10 %Productos recomendados
biological source
human
recombinant
expressed in E. coli
assay
≥70% (SDS-PAGE)
form
aqueous solution
mol wt
32 kDa
packaging
pkg of 500 μg
storage condition
avoid repeated freeze/thaw cycles
concentration
>0.02 mg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−70°C
Gene Information
human ... HIST1H3E(8353)
General description
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.
Application
Biochem/physiol Actions
Physical form
Preparation Note
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
-
What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico