SAB5702775

Anti-MDH1 Antibody, clone 8U9X1, Rabbit Monoclonal

• Sinónimos: HEL-S-32, MDH-s, MDHA, MGC:1375, MOR2
• UNSPSC Code: 12352203
• NACRES: NA.46

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 8U9X1, monoclonal
• form: liquid
• mol wt: 36 kDa
• species reactivity: human, rat, rat
• concentration: 0.16 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: IKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
• UniProt accession no.: P40925
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MDH1(4190)

Descripción

General description

This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. [provided by RefSeq, Feb 2016]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1