Saltar al contenido
MilliporeSigma
Todas las fotos(7)

Documentos clave

SAB2108614

Sigma-Aldrich

Anti-GADD45B

affinity isolated antibody

Sinónimos:

Anti- MYD118

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$541.00

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

18 kDa

reactividad de especies

bovine, human, dog, horse, pig, mouse, rat

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable
immunohistochemistry: suitable

nº de acceso

NM_015675

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... GADD45B(4616)

Descripción general

Growth arrest and DNA damage-inducible 45 (GADD45B) gene is located on human chromosome 19p13.3.

Inmunógeno

Synthetic peptide directed towards the middle region of human GADD45B

Acciones bioquímicas o fisiológicas

sGrowth arrest and DNA damage-inducible 45 (GADD45B) acts as a tumor suppressor gene through p53-mediated apoptotic pathways. GADD45B helps to maintain chondrocyte homeostasis by regulating the expression of collagen gene.

Secuencia

Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Abnormal expression of GADD45B in human colorectal carcinoma
Wang, Lis, et al.
Journal of Translational Medicine, 10(1), 215-215 (2012)
Differential expression of GADD45$\beta$ in normal and osteoarthritic cartilage: potential role in homeostasis of articular chondrocytes
Ijiri, Ko, et al.
Arthritis and Rheumatism, 58(7), 2075-2087 (2008)
S Oesterreich et al.
British journal of cancer, 84(4), 493-498 (2001-02-24)
We have recently discovered that the nuclear matrix protein SAFB is an oestrogen receptor corepressor. Since it has become clear that many steroid receptor cofactors play important roles in breast tumorigenesis, we investigated whether SAFB could also be involved in
Liming Yu et al.
Nature communications, 14(1), 4101-4101 (2023-07-26)
Hypercholesterolemia and vascular inflammation are key interconnected contributors to the pathogenesis of atherosclerosis. How hypercholesterolemia initiates vascular inflammation is poorly understood. Here we show in male mice that hypercholesterolemia-driven endothelial activation, monocyte recruitment and atherosclerotic lesion formation are promoted by

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico