Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

SAB2104963

Sigma-Aldrich

Anti-FAM135B antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-C8ORFK32, Anti-MGC126009, Anti-MGC126010, Anti-MGC33221

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

156 kDa

reactividad de especies

human, guinea pig, bovine, mouse, horse, dog, rabbit, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... FAM135B(51059)

Descripción general

FAM135B (family with sequence similarity 135 member B) gene is localized to human chromosome 8. This gene shows wide level of tissue expression, including heart and brain.

Inmunógeno

Synthetic peptide directed towards the middle region of human FAM135B

Acciones bioquímicas o fisiológicas

FAM135B (family with sequence similarity 135 member B) is a new oncogene that facilitates malignancy in SCC (squamous cell carcinoma) cells and ESCC (esophageal SCC). This gene participates in cell activity and signaling, including in brain. Polymorphism in this gene is linked with extrapulmonary tuberculosis.

Secuencia

Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jalil Pirayesh Islamian et al.
Cancer biology & medicine, 11(2), 78-85 (2014-07-11)
Esophageal cancer has been reported as the ninth most common malignancy and ranks as the sixth most frequent cause of death worldwide. Esophageal cancer treatment involves surgery, chemotherapy, radiation therapy, or combination therapy. Novel strategies are needed to boost the
Noffisat O Oki et al.
BMC research notes, 4, 28-28 (2011-02-02)
Approximately 5-10% of persons infected with M. tuberculosis develop tuberculosis, but the factors associated with disease progression are incompletely understood. Both linkage and association studies have identified human genetic variants associated with susceptibility to pulmonary tuberculosis, but few genetic studies
Abbes Belkhiri et al.
Oncotarget, 6(3), 1348-1358 (2015-01-17)
Esophageal cancer, comprising squamous carcinoma and adenocarcinoma, is a leading cause of cancer-related death in the world. Notably, the incidence of esophageal adenocarcinoma has increased at an alarming rate in the Western world. Unfortunately, the standard first-line chemo-radiotherapeutic approaches are

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico