SAB2102744

Anti-ZBTB39 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-KIAA0352, Anti-Zinc finger and BTB domain containing 39
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 79 kDa
• species reactivity: pig, human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: O15060
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZBTB39(9880)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human ZBTB39

Biochem/physiol Actions

ZBTB39 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB39 may be involved in transcriptional regulation.

Sequence

Synthetic peptide located within the following region: CRLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGLQHPALQKRKLPAEEF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable