SAB2102693

Anti-WDFY3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ALFY, Anti-KIAA0993, Anti-MGC16461, Anti-WD repeat and FYVE domain containing 3, Anti-ZFYVE25
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 90 kDa
• species reactivity: rat, human, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q8IZQ1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... WDFY3(23001)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human WDFY3

Biochem/physiol Actions

WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Sequence

Synthetic peptide located within the following region: LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHLALLVMETLTV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable