SAB2101648

Anti-NR2F2 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

• Sinónimos: Anti-ARP1, Anti-COUP-TFII, Anti-COUPTFB, Anti-MGC117452, Anti-Nuclear receptor subfamily 2, group F, member 2
• MDL number: MFCD07370450
• UNSPSC Code: 12352203

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: lyophilized powder
• mol wt: 45 kDa
• species reactivity: mouse, human, bovine, canine, rabbit, rat, chicken
• technique(s): western blot: suitable
• immunogen sequence: MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAS
• UniProt accession no.: P24468
• storage temp.: −20°C
• Gene Information: human ... NR2F2(7026)

Descripción

Immunogen

Peptide region of the protein sequence according to NP_066285.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 13 - Non Combustible Solids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable