SAB2101578

Anti-NFATC3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-NFAT4, Anti-NFATX, Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 115 kDa
• species reactivity: dog, mouse, human, horse, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: Q12968
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NFATC3(4775)

Descripción

General description

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) belongs to the NFAT family. It is expressed at high levels in the thymus. NFATc3 has a rel similarity domain (RSD) and the SP repeat region, characterized by the repeated motif SPxxSPxxSPrxsxx(D/E)(D/E)swl. The NFATc3 gene is located on human chromosome 16.

Immunogen

Synthetic peptide directed towards the N terminal region of human NFATC3

Application

Anti-NFATC3 antibody produced in rabbit has been used in western blot analysis (1:1000).

Biochem/physiol Actions

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) exhibits either pro-tumor or anti-tumor effects. It can block the proliferation and migration abilities of hepatoma cells. NFATc3 aids in reducing hepatitis B virus (HBV) replication. It can activate transcription. NFAT4 is necessary to drive the expression of the human polyomavirus JC virus (JCV) gene in glial cells.

Sequence

Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable