SAB2100687

Anti-EPB41 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-4.1R, Anti-EL1, Anti-Erythrocyte membrane protein band 4.1, Anti-HE
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 85 kDa
• species reactivity: human, guinea pig, dog, mouse, rat, horse, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q4VB86
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... EPB41(2035)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human EPB41

Biochem/physiol Actions

Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. ′Rh-unlinked′ forms of elliptocytosis are caused by mutation in the alpha-spectrin gene, the beta-spectrin gene, or the band 3 gene.Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. ′Rh-unlinked′ forms of elliptocytosis are caused by mutation in the alpha-spectrin gene (MIM 182860), the beta-spectrin gene (MIM 182870), or the band 3 gene (MIM 109270).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-95 BM465039.1 1-95 96-2238 J03796.1 40-2182 2239-2780 AL833483.1 1799-2340 2781-2943 BU184161.1 560-722 2944-3952 AL833483.1 2504-3512 3953-4352 BM997767.1 226-625 4353-4796 BE257308.1 115-558 4797-5656 BC009063.1 442-1301 5657-6064 BM740451.1 1-408 c

Sequence

Synthetic peptide located within the following region: SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable