Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

SAB2100604

Sigma-Aldrich

Anti-DNAJB1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-DnaJ (Hsp40) homolog, subfamily B, member 1, Anti-HSPF1, Anti-Hdj1, Anti-Hsp40, Anti-Sis1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$541.00

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$541.00

About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

38 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... DNAJB1(3337)

Descripción general

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) belongs to the heat shock protein 40 (HSP40) protein family. It contains a highly conserved J domain. The DNAJB1 gene is mapped to human chromosome 19p13.12.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human DNAJB1

Aplicación

Anti-DNAJB1 antibody produced in rabbit has been used in western blotting (1:500).[1]

Acciones bioquímicas o fisiológicas

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) interacts with heat shock protein 70 (HSP70) and can stimulate its ATPase activity. It stimulates the association between heat shock cognate 70 kDa protein (HSC70) and Hsc70-interacting protein (HIP). In association with HSP70, HSP40 favors adenosine triphosphate (ATP)-dependent protein refolding, transport, and interaction. It acts as a negative regulator melanoma differentiation-associated gene 5 (MDA5) based mitochondrial antiviral signaling protein pathway and mitogen-inducible gene 6 (MIG6). It also blocks p53 mediated apoptosis by destabilizing programmed cell death 5 (PDCD5). Hsp40 mediates viral ribonucleoproteins (vRNPs) import and may serve as a potential antiviral target.

Secuencia

Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Xiao-Ting Feng et al.
BMC developmental biology, 19(1), 9-9 (2019-04-27)
Coilia nasus oogenesis/spawning migration is a well-defined synchronous arrangement process. DnaJs are indispensable molecular chaperones for oogenesis process. However, how DnaJs involved the anadromous spawning migration mechanism is outstanding and plausible. In this regard, two DnaJs (Cn-DnaJa1 and Cn-DnaJb1) are
Soo-Yeon Park et al.
Biochimica et biophysica acta, 1853(10 Pt A), 2722-2730 (2015-08-05)
Mitogen-inducible gene 6 (MIG6) is a tumor suppressor implicated in the development of human cancers; however, the regulatory mechanisms of MIG6 remain unknown. Here, using a yeast two-hybrid screen, we identified DnaJ homolog subfamily B member I (DNAJB1) as a
Monika Vyas et al.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 33(4), 648-656 (2019-11-05)
Recently discovered DNAJB1-PRKACA oncogenic fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma. In this study, we describe six pancreatobiliary neoplasms with PRKACA fusions, five of which harbor the DNAJB1-PRKACA fusion. All neoplasms were subjected to a hybridization capture-based next-generation
Jyoti Batra et al.
Scientific reports, 6, 19063-19063 (2016-01-12)
A unique feature of influenza A virus (IAV) life cycle is replication of the viral genome in the host cell nucleus. The nuclear import of IAV genome is an indispensable step in establishing virus infection. IAV nucleoprotein (NP) is known
Ken Takashima et al.
Journal of innate immunity, 10(1), 44-55 (2017-10-27)
Melanoma differentiation-associated gene 5 (MDA5) is a pattern recognition receptor that recognizes cytoplasmic viral double-stranded RNA (dsRNA) and initiates rapid innate antiviral responses. MDA5 forms a filament-like multimer along the dsRNA leading to oligomerization, which in turn activates the adaptor

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico