SAB1413281

Monoclonal Anti-RLF antibody produced in mouse

clone 2G2, purified immunoglobulin, buffered aqueous solution

• Sinónimos: RLF
• UNSPSC Code: 51111800

Propiedades

• conjugate: unconjugated
• Quality Level: 100
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2G2, monoclonal
• form: buffered aqueous solution
• mol wt: 37.73 kDa
• species reactivity: human
• concentration: ~0.3-1 μg/μL
• technique(s): ELISA: suitable; western blot: suitable
• isotype: IgG2a, kappa
• Protein ID accession no.: NM_012421
• shipped in: dry ice
• storage temp.: -10 to -25°C
• target post-translational modification: unmodified
• Gene Information: human ... RLF(6018)

Descripción

General description

Mouse monoclonal antibody raised against a partial recombinant RLF.

Immunogen

RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence

SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS

Physical form

Solution in phosphate buffered saline, pH 7.4

Preparation Note

Purification by Protein A sepharose

Storage and Stability

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable