Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

SAB1412264

Sigma-Aldrich

ANTI-SP1 antibody produced in mouse

clone 1G9, purified immunoglobulin, buffered aqueous solution

Sinónimos:

SP1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1G9, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 36.41 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SP1(6667)

Descripción general

Sp1 protein was the first transcription factor to be cloned and characterized. It was first detected in HeLa cells on the basis of its ability to activate the SV40 early promoter transcription. Analysis of structure and function has revealed that Sp1 can be separated into discrete functional domains. The DNA-binding domain consists of three zinc fingers that specifically bind to the GC-box element.

Inmunógeno

SP1 (NP_612482, 522 a.a. ~ 618 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*

Acciones bioquímicas o fisiológicas

Sp1 protein was shown to recognize and bind selectively to a GC-rich consensus sequence (GC-box: GGGCGG or CACCC) that presents in the promoter of several important cellular genes, including Simian vacuolating virus 40 (SV40) early, human immunodeficiency virus-1 (HIV-1), platelet-derived growth factor subunit B (PDGF-B), Myc, c-Src etc. In addition to transcription, Sp1 function has been linked to cell growth, cancer and Huntington disease.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Structures of zinc finger domains from transcription factor Sp1. Insights into sequence-specific protein-DNA recognition.
Narayan VA
The Journal of Biological Chemistry, 272(12), 7801-7809 (1997)
Mithramycin is a gene-selective Sp1 inhibitor that identifies a biological intersection between cancer and neurodegeneration.
Sleiman SF
The Journal of Neuroscience, 31(18), 6858-6870 (2011)
Decreased association of the transcription factor Sp1 with genes downregulated in Huntington's disease.
Chen-Plotkin AS
Neurobiology of Disease, 22(2), 233-241 (2006)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico