SAB1410841

Anti-ATP1B3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinónimos: ATPB-3, CD298, FLJ29027
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 31.5 kDa
• reactividad de especies: human, rat
• técnicas: western blot: 1 μg/mL
• Nº de acceso NCBI: NM_001679
• Nº de acceso UniProt: P54709
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ATP1B3(483)

Descripción

Descripción general

ATPase Na⁺/K⁺ transporting subunit Β 3 (ATP1B3) is a 43kDa protein, encoded by the gene mapped to human chromosome 3q23. The encoded protein is a member of subfamily of Na⁺/K⁺ -ATPases.

Inmunógeno

ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.

Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

Acciones bioquímicas o fisiológicas

ATPase Na⁺/K⁺ transporting subunit Β 3 (ATP1B3) suppress enterovirus 71 (EV71) replication by elevating the production of type-I interferons, which might act as a potential target in treatment of EV71 infection. The encoded protein is also involved in the regulation of the immune response. Experimental study suggest that ATP1B3 can control restriction of HIV-1 production and nuclear factor Κ B (NF-ΚB) activation in a bone marrow stromal cell antigen 2 (BST-2) dependent manner. Elevated expression of ATP1B3 has been observed in colon and lung cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable