SAB1410841

Anti-ATP1B3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinónimos: ATPB-3, CD298, FLJ29027
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 31.5 kDa
• species reactivity: human, rat
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_001679
• UniProt accession no.: P54709
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ATP1B3(483)

Descripción

General description

ATPase Na⁺/K⁺ transporting subunit Β 3 (ATP1B3) is a 43kDa protein, encoded by the gene mapped to human chromosome 3q23. The encoded protein is a member of subfamily of Na⁺/K⁺ -ATPases.

Immunogen

ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.

Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

Biochem/physiol Actions

ATPase Na⁺/K⁺ transporting subunit Β 3 (ATP1B3) suppress enterovirus 71 (EV71) replication by elevating the production of type-I interferons, which might act as a potential target in treatment of EV71 infection. The encoded protein is also involved in the regulation of the immune response. Experimental study suggest that ATP1B3 can control restriction of HIV-1 production and nuclear factor Κ B (NF-ΚB) activation in a bone marrow stromal cell antigen 2 (BST-2) dependent manner. Elevated expression of ATP1B3 has been observed in colon and lung cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable