Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

SAB1409675

Sigma-Aldrich

Monoclonal Anti-BMP7 antibody produced in mouse

clone 1H3, purified immunoglobulin, buffered aqueous solution

Sinónimos:

OP-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1H3, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 36.41 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... BMP7(655)

Descripción general

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. (provided by RefSeq)

Inmunógeno

BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET

Acciones bioquímicas o fisiológicas

As implied by their name, bone morphogenetic proteins (BMPs) promote and regulate bone development and growth. BMP-7 induces apoptosis in B-cells. It has a role in organ development and may have a role in liver regeneration. Mutations in the gene encoding the protein have been shown to affect the development of teeth, palate and other orofacial complexes.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

BMP7 expression correlates with secondary drug resistance in mantle cell lymphoma.
Camara-Clayette V
PLoS ONE, 8(9), e73993-e73993 (2013)
BMP7 Gene involved in nonsyndromic orofacial clefts in Western Han Chinese.
Yu Q
Medicina Oral, patologia Oral y cirugia Bucal, 20(3), e298-e304 (2015)
Are bone morphogenetic protein-7 (BMP-7) serum levels correlated with development of hepatic fibrosis?
Aktug Demir N
Journal of Infection in Developing Countries, 8(5), 605-610 (2014)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico