Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

SAB1409662

Sigma-Aldrich

Monoclonal Anti-RBM15 antibody produced in mouse

clone 2C1, purified immunoglobulin, buffered aqueous solution

Sinónimos:

FLJ12479, FLJ21943, MGC119584, OTT, OTT1, SPEN

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.43

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2C1, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 37.84 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable

isotipo

IgG1κ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... RBM15(64783)

Descripción general

Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM

Inmunógeno

RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL

Acciones bioquímicas o fisiológicas

RBM15 (RNA binding motif protein 15) is an RTE (RNA transport element) binding factor majorly involved in the mRNA export. It plays a vital role in the NXF (Nuclear export factor) pathway. It directly binds to NXF1 and provides receptor for the RNA export element RTE. This conjugated form helps to enhance RTE-mediated expression. RBM15 has the ability to identify specific RTE RNA in vitro, which finally enhances export and expression of RTE-containing reporter mRNAs in vivo.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Susan Lindtner et al.
The Journal of biological chemistry, 281(48), 36915-36928 (2006-09-27)
Retroviruses/retroelements provide tools enabling the identification and dissection of basic steps for post-transcriptional regulation of cellular mRNAs. The RNA transport element (RTE) identified in mouse retrotransposons is functionally equivalent to constitutive transport element of Type D retroviruses, yet does not
Andrei S Zolotukhin et al.
Nucleic acids research, 37(21), 7151-7162 (2009-09-30)
The conserved mRNA export receptor NXF1 (Mex67 in yeast) assembles with messenger ribonucleoproteins (mRNP) in the nucleus and guides them through the nuclear pore complex into the cytoplasm. The DEAD family RNA helicase Dbp5 is essential for nuclear export of

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico